PDB entry 1f6v

View 1f6v on RCSB PDB site
Description: solution structure of the c terminal of mu b transposition protein
Class: DNA binding protein
Keywords: Mu phage, recombination, transposition, ATPase, DNA binding, high salt, solution structure, DNA BINDING PROTEIN
Deposited on 2000-06-23, released 2000-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA transposition protein
  Species: Enterobacteria phage Mu [TaxId:10677]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03763 (1-90)
    • cloning artifact (0)
  Domains in SCOPe 2.08: d1f6va1, d1f6va2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f6vA (A:)
  gsriakrtainktkkadvkaiadawqingekelellqqiaqkpgalrilnhslrlaamta
  hgkgervnedylrqafreldldvdistllrn