PDB entry 1f6n

View 1f6n on RCSB PDB site
Description: crystal structure analysis of the mutant reaction center pro l209-> tyr from the photosynthetic purple bacterium rhodobacter sphaeroides
Deposited on 2000-06-22, released 2001-04-18
The last revision prior to the SCOP 1.59 freeze date was dated 2001-04-18, with a file datestamp of 2001-04-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.221
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6nH (H:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrks
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6nL (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtydhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6nM (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hg