PDB entry 1f6m

View 1f6m on RCSB PDB site
Description: crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+
Class: oxidoreductase
Keywords: ALTERNATE CONFORMATION, TERNARY COMPLEX, DOMAIN MOTION, redox-active center, NADP, FAD, electron transport, OXIDOREDUCTASE
Deposited on 2000-06-22, released 2000-08-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.205
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9P4 (0-319)
      • engineered (134)
    Domains in SCOPe 2.06: d1f6ma1, d1f6ma2
  • Chain 'B':
    Compound: thioredoxin reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9P4 (0-319)
      • engineered (134)
    Domains in SCOPe 2.06: d1f6mb1, d1f6mb2
  • Chain 'C':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-107)
      • engineered (34)
    Domains in SCOPe 2.06: d1f6mc_
  • Chain 'D':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-107)
      • engineered (34)
    Domains in SCOPe 2.06: d1f6md_
  • Chain 'E':
    Compound: thioredoxin reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9P4 (0-319)
      • engineered (134)
    Domains in SCOPe 2.06: d1f6me1, d1f6me2
  • Chain 'F':
    Compound: thioredoxin reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9P4 (0-319)
      • engineered (134)
    Domains in SCOPe 2.06: d1f6mf1, d1f6mf2
  • Chain 'G':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-107)
      • engineered (34)
    Domains in SCOPe 2.06: d1f6mg_
  • Chain 'H':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-107)
      • engineered (34)
    Domains in SCOPe 2.06: d1f6mh_
  • Heterogens: FAD, 3AA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mA (A:)
    gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
    gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasarylg
    lpseeafkgrgvsasatcdgffyrnqkvavigggntaveealylsniasevhlihrrdgf
    raekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvaglf
    vaighspntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsag
    tgcmaaldaeryldgladak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mB (B:)
    gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
    gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasarylg
    lpseeafkgrgvsasatcdgffyrnqkvavigggntaveealylsniasevhlihrrdgf
    raekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvaglf
    vaighspntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsag
    tgcmaaldaeryldgladak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mC (C:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpskmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mD (D:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpskmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mE (E:)
    gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
    gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasarylg
    lpseeafkgrgvsasatcdgffyrnqkvavigggntaveealylsniasevhlihrrdgf
    raekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvaglf
    vaighspntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsag
    tgcmaaldaeryldgladak
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mF (F:)
    gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
    gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasarylg
    lpseeafkgrgvsasatcdgffyrnqkvavigggntaveealylsniasevhlihrrdgf
    raekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvaglf
    vaighspntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsag
    tgcmaaldaeryldgladak
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mG (G:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpskmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mH (H:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpskmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla