PDB entry 1f6m

View 1f6m on RCSB PDB site
Description: crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+
Deposited on 2000-06-22, released 2000-08-30
The last revision prior to the SCOP 1.67 freeze date was dated 2000-11-08, with a file datestamp of 2000-11-08.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.205
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mA (A:)
    gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
    gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasarylg
    lpseeafkgrgvsasatcdgffyrnqkvavigggntaveealylsniasevhlihrrdgf
    raekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvaglf
    vaighspntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsag
    tgcmaaldaeryldgladak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mB (B:)
    gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
    gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasarylg
    lpseeafkgrgvsasatcdgffyrnqkvavigggntaveealylsniasevhlihrrdgf
    raekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvaglf
    vaighspntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsag
    tgcmaaldaeryldgladak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mC (C:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpskmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mD (D:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpskmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mE (E:)
    gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
    gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasarylg
    lpseeafkgrgvsasatcdgffyrnqkvavigggntaveealylsniasevhlihrrdgf
    raekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvaglf
    vaighspntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsag
    tgcmaaldaeryldgladak
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mF (F:)
    gttkhskllilgsgpagytaavyaaranlqpvlitgmekggqlttttevenwpgdpndlt
    gpllmermhehatkfeteiifdhinkvdlqnrpfrlngdngeytcdaliiatgasarylg
    lpseeafkgrgvsasatcdgffyrnqkvavigggntaveealylsniasevhlihrrdgf
    raekilikrlmdkvengniilhtnrtleevtgdqmgvtgvrlrdtqnsdniesldvaglf
    vaighspntaifegqlelengyikvqsgihgnatqtsipgvfaagdvmdhiyrqaitsag
    tgcmaaldaeryldgladak
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mG (G:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpskmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f6mH (H:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpskmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla