PDB entry 1f6b

View 1f6b on RCSB PDB site
Description: crystal structure of sar1-GDP complex
Class: protein transport
Keywords: gtpases, n-terminal helix, mg-containing complex, protein transport
Deposited on 2000-06-21, released 2002-01-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.22
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sar1
    Species: Cricetulus griseus [TaxId:10029]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1f6ba_
  • Chain 'B':
    Compound: sar1
    Species: Cricetulus griseus [TaxId:10029]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1f6bb_
  • Heterogens: MG, SO4, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f6bA (A:)
    msfifdwiysgfssvlqflglykktgklvflgldnagkttllhmlkddrlgqhvptlhpt
    seeltiagmtfttfdlgghiqarrvwknylpaingivflvdcadherlleskeeldslmt
    detianvpililgnkidrpeaiseerlremfglygqttgkgsvslkelnarplevfmcsv
    lkrqgygegfrwmaqyid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6bA (A:)
    ssvlqflglykktgklvflgldnagkttllhmlkddptlhptseeltiagmtfttfdlgg
    rrvwknylpaingivflvdcadherlleskeeldslmtdetianvpililgnkidrpeai
    seerlremfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrwmaqyid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f6bB (B:)
    msfifdwiysgfssvlqflglykktgklvflgldnagkttllhmlkddrlgqhvptlhpt
    seeltiagmtfttfdlgghiqarrvwknylpaingivflvdcadherlleskeeldslmt
    detianvpililgnkidrpeaiseerlremfglygqttgkgsvslkelnarplevfmcsv
    lkrqgygegfrwmaqyid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6bB (B:)
    ssvlqflglykktgklvflgldnagkttllhmlkddptlhptseeltiagmtfttfdlgg
    hiqarrvwknylpaingivflvdcadherlleskeeldslmtdetianvpililgnkidr
    peaiseerlremfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrwmaqyid