PDB entry 1f6a

View 1f6a on RCSB PDB site
Description: Structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)
Deposited on 2000-06-20, released 2000-07-20
The last revision prior to the SCOP 1.65 freeze date was dated 2000-07-20, with a file datestamp of 2000-07-20.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.254
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f6aA (A:)
    vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
    edsgeykcqhqqvaesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviy
    ykdgealkywyenhaisitnaaaedsgtyyctgkvwqldyeseplnitvikaprek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6aA (A:)
    vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
    edsgeykcqhqqvaesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviy
    ykdgealkywyenhaisitnaaaedsgtyyctgkvwqldyeseplnitvikap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f6aB (B:)
    adpcdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhs
    trkeekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapev
    yafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffv
    fsrlevtraeweqkdeficravheaaspsqtvqravsvnpgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6aB (B:)
    pcdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstr
    keekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevya
    fatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfs
    rlevtraeweqkdeficravheaaspsqtvqravsvn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f6aD (D:)
    adpcdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhs
    trkeekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapev
    yafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffv
    fsrlevtraeweqkdeficravheaaspsqtvqravsvnpgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6aD (D:)
    cdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrk
    eekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyaf
    atpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsr
    levtraeweqkdeficravheaaspsqtvqravsvn