PDB entry 1f6a

View 1f6a on RCSB PDB site
Description: Structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)
Class: immune system
Keywords: immunoglobulin fold, glycoprotein, receptor, ige-binding protein, ige antibody, ige-fc, immune system
Deposited on 2000-06-20, released 2000-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.254
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high affinity immunoglobulin epsilon receptor alpha-subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12319 (0-End)
      • engineered (73)
      • engineered (134)
      • engineered (141)
      • cloning artifact (142)
    Domains in SCOPe 2.07: d1f6aa1, d1f6aa2
  • Chain 'B':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01854 (4-End)
      • cloning artifact (2-3)
    Domains in SCOPe 2.07: d1f6ab1, d1f6ab2, d1f6ab3
  • Chain 'D':
    Compound: ig epsilon chain c region
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01854 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.07: d1f6ad1, d1f6ad2, d1f6ad3
  • Heterogens: SO4, CPS

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f6aA (A:)
    vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
    edsgeykcqhqqvaesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviy
    ykdgealkywyenhaisitnaaaedsgtyyctgkvwqldyeseplnitvikaprek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6aA (A:)
    vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
    edsgeykcqhqqvaesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviy
    ykdgealkywyenhaisitnaaaedsgtyyctgkvwqldyeseplnitvikap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f6aB (B:)
    adpcdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhs
    trkeekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapev
    yafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffv
    fsrlevtraeweqkdeficravheaaspsqtvqravsvnpgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6aB (B:)
    pcdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstr
    keekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevya
    fatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfs
    rlevtraeweqkdeficravheaaspsqtvqravsvn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f6aD (D:)
    adpcdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhs
    trkeekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapev
    yafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffv
    fsrlevtraeweqkdeficravheaaspsqtvqravsvnpgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f6aD (D:)
    cdsnprgvsaylsrpspfdlfirksptitclvvdlapskgtvnltwsrasgkpvnhstrk
    eekqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyaf
    atpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsr
    levtraeweqkdeficravheaaspsqtvqravsvn