PDB entry 1f60

View 1f60 on RCSB PDB site
Description: crystal structure of the yeast elongation factor complex eef1a:eef1ba
Deposited on 2000-06-19, released 2000-07-04
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-22, with a file datestamp of 2000-11-22.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.189
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f60A (A:)
    gkekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvld
    klkaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvg
    efeagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgy
    npktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrptd
    kplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqgv
    pgdnvgfnvknvsvkeirrgnvcgdakndppkgcasfnatvivlnhpgqisagyspvldc
    htahiacrfdellekndrrsgkkledhpkflksgdaalvkfvpskpmcveafseypplgr
    favrdmrqtvavgviksvdk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f60B (B:)
    paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
    dkvslddlqqsieededhvqstdiaamqkl