PDB entry 1f5o

View 1f5o on RCSB PDB site
Description: 2.9 angstrom crystal structure of deoxygenated lamprey hemoglobin v in the space group p2(1)2(1)2(1)
Class: oxygen storage/transport
Keywords: Hemoglobin, Heme, Lamprey, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2000-06-15, released 2000-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.192
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin v
    Species: Petromyzon marinus [TaxId:7757]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02208 (0-148)
      • see remark 999 (28)
      • see remark 999 (85)
    Domains in SCOPe 2.07: d1f5oa_
  • Chain 'B':
    Compound: hemoglobin v
    Species: Petromyzon marinus [TaxId:7757]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02208 (0-148)
      • see remark 999 (28)
      • see remark 999 (85)
    Domains in SCOPe 2.07: d1f5ob_
  • Chain 'C':
    Compound: hemoglobin v
    Species: Petromyzon marinus [TaxId:7757]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02208 (0-148)
      • see remark 999 (28)
      • see remark 999 (85)
    Domains in SCOPe 2.07: d1f5oc_
  • Chain 'D':
    Compound: hemoglobin v
    Species: Petromyzon marinus [TaxId:7757]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02208 (0-148)
      • see remark 999 (28)
      • see remark 999 (85)
    Domains in SCOPe 2.07: d1f5od_
  • Chain 'E':
    Compound: hemoglobin v
    Species: Petromyzon marinus [TaxId:7757]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02208 (0-148)
      • see remark 999 (28)
      • see remark 999 (85)
    Domains in SCOPe 2.07: d1f5oe_
  • Chain 'F':
    Compound: hemoglobin v
    Species: Petromyzon marinus [TaxId:7757]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02208 (0-148)
      • see remark 999 (28)
      • see remark 999 (85)
    Domains in SCOPe 2.07: d1f5of_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f5oA (A:)
    pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f5oB (B:)
    pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f5oC (C:)
    pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f5oD (D:)
    pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f5oE (E:)
    pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f5oF (F:)
    pivdtgsvaplsaaektkirsawapvystyetsgvdilvkfftstpaaqeffpkfkgltt
    adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
    aviadtvaagdagfeklmsmicillrsay