PDB entry 1f5n

View 1f5n on RCSB PDB site
Description: human guanylate binding protein-1 in complex with the GTP analogue, gmppnp.
Class: signaling protein
Keywords: GBP, GTP Hydrolysis, GDP, GMP, Interferon Induced, Dynamin related, Large GTPase family. GMPPNP, GPPNHP., SIGNALING PROTEIN
Deposited on 2000-06-15, released 2000-09-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.226
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interferon-induced guanylate-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32455
      • cloning artifact (506)
    Domains in SCOPe 2.03: d1f5na1, d1f5na2
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f5nA (A:)
    maseihmtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklag
    kkkgfslgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdnqndswifalav
    llsstfvynsigtinqqamdqlyyvtelthrirsksspdenenevedsadfvsffpdfvw
    tlrdfsldleadgqpltpdeyltyslklkkgtsqkdetfnlprlcirkffpkkkcfvfdr
    pvhrrklaqleklqdeeldpefvqqvadfcsyifsnsktktlsggiqvngprleslvlty
    vnaissgdlpcmenavlalaqiensaavqkaiahyeqqmgqkvqlpteslqelldlhrds
    ereaievfirssfkdvdhlfqkelaaqlekkrddfckqnqeassdrcsgllqvifsplee
    evkagiyskpggyrlfvqklqdlkkkyyeeprkgiqaeeilqtylkskesmtdailqtdq
    tltekekeievervkaesaqasakmlhemqrkneqmmeqkersyqehlkqltekmendrv
    qllkeqertlalklqeqeqllkegfqkesrimkneiqdlqtkmrrrkactis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f5nA (A:)
    mtgpmclientngrlmanpealkilsaitqpmvvvaivglyrtgksylmnklagkkkgfs
    lgstvqshtkgiwmwcvphpkkpghilvlldteglgdvekgdnqndswifalavllsstf
    vynsigtinqqamdqlyyvtelthrirskssvedsadfvsffpdfvwtlrdfsldleadg
    qpltpdeyltyslklkkgtsqkdetfnlprlcirkffpkkkcfvfdrpvhrrklaqlekl
    qdeeldpefvqqvadfcsyifsnsktktlsggiqvngprleslvltyvnaissgdlpcme
    navlalaqiensaavqkaiahyeqqmgqkvqlpteslqelldlhrdsereaievfirssf
    kdvdhlfqkelaaqlekkrddfckqnqeassdrcsgllqvifspleeevkagiyskpggy
    rlfvqklqdlkkkyyeeprkgiqaeeilqtylkskesmtdailqtdqtltekekeiever
    vkaesaqasakmlhemqrkneqmmeqkersyqehlkqltekmendrvqllkeqertlalk
    lqeqeqllkegfqkesrimkneiqdlqtkm