PDB entry 1f5a

View 1f5a on RCSB PDB site
Description: crystal structure of mammalian poly(a) polymerase
Deposited on 2000-06-13, released 2000-09-13
The last revision prior to the SCOP 1.61 freeze date was dated 2000-09-13, with a file datestamp of 2000-09-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f5aA (A:)
    ygitspislaapketdclltqklvetlkpfgvfeeeeelqrrililgklnnlvkewirei
    sesknlpqsvienvggkiftfgsyrlgvhtkgadidalcvaprhvdrsdfftsfydklkl
    qeevkdlraveeafvpviklcfdgieidilfarlalqtipedldlrddsllknldircir
    slngcrvtdeilhlvpnidnfrltlraiklwakrhniysnilgflggvswamlvartcql
    ypnaiastlvhkfflvfskwewpnpvllkqpeecnlnlpvwdprvnpsdryhlmpiitpa
    ypqqnstynvsvstrmvmveefkqglaitdeillskaewsklfeapnffqkykhyivlla
    saptekqrlewvglveskirilvgsleknefitlahvnpqsfpapkenpdkeefrtmwvi
    glvfkktensenlsvdltydiqsftdtvyrqainskmfevdmkiaamhvkrkqlhqllp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f5aA (A:)
    ygitspislaapketdclltqklvetlkpfgvfeeeeelqrrililgklnnlvkewirei
    sesknlpqsvienvggkiftfgsyrlgvhtkgadidalcvaprhvdrsdfftsfydklkl
    qeevkdlraveeafvpviklcfdgieidilfarlalqtipedldlrddsllknldircir
    slngcrvtdeilhlvpnidnfrltlraiklwakrhniysnilgflggvswamlvartcql
    ypnaiastlvhkfflvfskwewpnpvllkqpeecnlnlpvwdprvnpsdryhlmpiitpa
    ypqqnstynvsvstrmvmveefkqglaitdeillskaewsklfeapnffqkykhyivlla
    saptekqrlewvglveskirilvgsleknefitlahvnpqsfpakeefrtmwviglvfkd
    ltydiqsftdtvyrqainskmfevdmkiaamhvkrkqlhqllp