PDB entry 1f58

View 1f58 on RCSB PDB site
Description: igg1 fab fragment (58.2) complex with 24-residue peptide (residues 308-333 of hiv-1 gp120 (mn isolate) with ala to aib substitution at position 323
Class: Viral protein/Immune system
Keywords: IMMUNOGLOBULIN, FAB, HIV-1, GP120, V3, Viral protein/Immune system COMPLEX
Deposited on 1998-10-21, released 1999-02-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (igg1 antibody 58.2 (heavy chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01869 (0-227)
      • conflict (5)
      • conflict (9)
      • conflict (28)
      • conflict (31)
      • conflict (33-34)
      • conflict (48)
      • conflict (52)
      • conflict (55-56)
      • conflict (58)
      • conflict (97-102)
      • conflict (120)
      • conflict (125)
      • conflict (199-200)
      • engineered (103)
      • engineered (103)
      • engineered (103)
      • engineered (103)
      • engineered (103)
      • engineered (103)
      • engineered (113-114)
    Domains in SCOPe 2.05: d1f58h1, d1f58h2
  • Chain 'L':
    Compound: protein (igg1 antibody 58.2 (light chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S68241 (0-215)
      • conflict (0-1)
      • conflict (23)
      • conflict (26)
      • conflict (26)
      • conflict (26)
      • conflict (26)
      • conflict (31)
      • conflict (33-35)
      • conflict (37)
      • conflict (52-53)
      • conflict (55-56)
      • conflict (61)
      • conflict (68)
      • conflict (86)
      • conflict (93)
      • conflict (95)
      • conflict (97)
    Domains in SCOPe 2.05: d1f58l1, d1f58l2
  • Chain 'P':
    Compound: protein (exterior membrane glycoprotein(gp120))
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05877
      • engineered (13)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f58H (H:)
    dvqlqqsgpdlvkpsqslsltctvtgysitsgyswhwirqfpgnklewmgyihysagtny
    npslksrisitrdtsknqfflqlnsvttedtatyycareeampygnqayyyamdcwgqgt
    tvtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfp
    avlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f58L (L:)
    divltqspaslavslgqratisckasqgvdfdgasfmnwyqqkpgqppkllifaastles
    giparfsgrgsgtdftlnihpveeedaatyycqqshedpltfgagtklelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnra
    

  • Chain 'P':
    No sequence available.