PDB entry 1f58
View 1f58 on RCSB PDB site
Description: igg1 fab fragment (58.2) complex with 24-residue peptide (residues 308-333 of hiv-1 gp120 (mn isolate) with ala to aib substitution at position 323
Class: Viral protein/Immune system
Keywords: immunoglobulin, fab, hiv-1, gp120, v3
Deposited on
1998-10-21, released
1999-02-02
The last revision prior to the SCOP 1.73 freeze date was dated
2003-04-01, with a file datestamp of
2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: protein (igg1 antibody 58.2 (heavy chain))
Species: Mus musculus
Database cross-references and differences (RAF-indexed):
- Uniprot P01869 (0-227)
- conflict (5)
- conflict (9)
- conflict (28)
- conflict (31)
- conflict (33-34)
- conflict (48)
- conflict (52)
- conflict (55-56)
- conflict (58)
- conflict (97-102)
- conflict (120)
- conflict (125)
- conflict (199-200)
- engineered (103)
- engineered (103)
- engineered (103)
- engineered (103)
- engineered (103)
- engineered (103)
- engineered (113-114)
Domains in SCOP 1.73: d1f58h1, d1f58h2 - Chain 'L':
Compound: protein (igg1 antibody 58.2 (light chain))
Species: Mus musculus
Database cross-references and differences (RAF-indexed):
- PIR S68241 (0-215)
- conflict (0-1)
- conflict (23)
- conflict (26)
- conflict (26)
- conflict (26)
- conflict (26)
- conflict (31)
- conflict (33-35)
- conflict (37)
- conflict (52-53)
- conflict (55-56)
- conflict (61)
- conflict (68)
- conflict (86)
- conflict (93)
- conflict (95)
- conflict (97)
Domains in SCOP 1.73: d1f58l1, d1f58l2 - Chain 'P':
Compound: protein (exterior membrane glycoprotein(gp120))
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>1f58H (H:)
dvqlqqsgpdlvkpsqslsltctvtgysitsgyswhwirqfpgnklewmgyihysagtny
npslksrisitrdtsknqfflqlnsvttedtatyycareeampygnqayyyamdcwgqgt
tvtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfp
avlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>1f58L (L:)
divltqspaslavslgqratisckasqgvdfdgasfmnwyqqkpgqppkllifaastles
giparfsgrgsgtdftlnihpveeedaatyycqqshedpltfgagtklelkradaaptvs
ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
stltltkdeyerhnsytceathktstspivksfnra
- Chain 'P':
No sequence available.