PDB entry 1f58

View 1f58 on RCSB PDB site
Description: igg1 fab fragment (58.2) complex with 24-residue peptide (residues 308-333 of hiv-1 gp120 (mn isolate) with ala to aib substitution at position 323
Deposited on 1998-10-21, released 1999-02-02
The last revision prior to the SCOP 1.71 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f58H (H:)
    dvqlqqsgpdlvkpsqslsltctvtgysitsgyswhwirqfpgnklewmgyihysagtny
    npslksrisitrdtsknqfflqlnsvttedtatyycareeampygnqayyyamdcwgqgt
    tvtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfp
    avlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f58L (L:)
    divltqspaslavslgqratisckasqgvdfdgasfmnwyqqkpgqppkllifaastles
    giparfsgrgsgtdftlnihpveeedaatyycqqshedpltfgagtklelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnra