PDB entry 1f56

View 1f56 on RCSB PDB site
Description: spinach plantacyanin
Deposited on 2000-06-13, released 2000-11-01
The last revision prior to the SCOP 1.57 freeze date was dated 2000-11-01, with a file datestamp of 2000-11-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.162
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1f56a_
  • Chain 'B':
    Domains in SCOP 1.57: d1f56b_
  • Chain 'C':
    Domains in SCOP 1.57: d1f56c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f56A (A:)
    avynigwsfnvngargksfragdvlvfkyikgqhnvvavngrgyascsaprgartyssgq
    drikltrgqnyficsfpghcgggmkiainak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f56B (B:)
    avynigwsfnvngargksfragdvlvfkyikgqhnvvavngrgyascsaprgartyssgq
    drikltrgqnyficsfpghcgggmkiainak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f56C (C:)
    avynigwsfnvngargksfragdvlvfkyikgqhnvvavngrgyascsaprgartyssgq
    drikltrgqnyficsfpghcgggmkiainak