PDB entry 1f55

View 1f55 on RCSB PDB site
Description: solution structure of the calcium bound n-terminal domain of yeast calmodulin
Deposited on 2000-06-13, released 2003-07-15
The last revision prior to the SCOP 1.67 freeze date was dated 2003-07-15, with a file datestamp of 2003-07-15.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1f55a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f55A (A:)
  ssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgn
  hqiefseflalmsrqlk