PDB entry 1f55

View 1f55 on RCSB PDB site
Description: solution structure of the calcium bound n-terminal domain of yeast calmodulin
Class: transport protein
Keywords: EF-hand, helix-loop-helix, TRANSPORT PROTEIN
Deposited on 2000-06-13, released 2003-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f55a_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f55A (A:)
    ssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgn
    hqiefseflalmsrqlk