PDB entry 1f54

View 1f54 on RCSB PDB site
Description: solution structure of the apo n-terminal domain of yeast calmodulin
Class: transport protein
Keywords: EF-hand, helix-loop-helix, TRANSPORT PROTEIN
Deposited on 2000-06-13, released 2003-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calmodulin
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06787 (0-76)
  Domains in SCOPe 2.08: d1f54a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f54A (A:)
  ssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgn
  hqiefseflalmsrqlk