PDB entry 1f50

View 1f50 on RCSB PDB site
Description: bacteriorhodopsin-br state of the e204q mutant at 1.7 angstrom resolution
Deposited on 2000-06-10, released 2000-08-09
The last revision prior to the SCOP 1.61 freeze date was dated 2000-08-09, with a file datestamp of 2000-08-09.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.132
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1f50a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f50A (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
    ypvvwligsegagivplniqtllfmvldvsakvgfglillrsraifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f50A (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgfsmrpevastfkvlrnvtvvlwsaypvvw
    ligsegagivplniqtllfmvldvsakvgfglillrsraifg