PDB entry 1f4z

View 1f4z on RCSB PDB site
Description: bacteriorhodopsin-m photointermediate state of the e204q mutant at 1.8 angstrom resolution
Deposited on 2000-06-10, released 2000-08-09
The last revision prior to the SCOP 1.61 freeze date was dated 2001-05-23, with a file datestamp of 2001-05-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.142
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1f4za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f4zA (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
    ypvvwligsegagivplniqtllfmvldvsakvgfglillrsraifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f4zA (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgfsmrpevastfkvlrnvtvvlwsaypvvw
    ligsegagivplniqtllfmvldvsakvgfglillrsraifg