PDB entry 1f4y

View 1f4y on RCSB PDB site
Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
Deposited on 2000-06-10, released 2000-08-02
The last revision prior to the SCOP 1.63 freeze date was dated 2000-08-02, with a file datestamp of 2000-08-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.226
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4yH (H:)
    evqleesggglvtpggslrlscaasgyvfstydmswvrqtpekrlewvafissgggrtsy
    pdtvkgrftisrddakntlylqmsslqsedtamyyctrhfyavldywgrgttltvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4yL (L:)
    qavvtqesalttspgetvtltcrsstgtvttsnyanwvqekpdhlftgligatnnraagv
    pvrfsgsliggkaaltitgaqtedeaiyfcalwysghwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtveksls