PDB entry 1f4l

View 1f4l on RCSB PDB site
Description: crystal structure of the e.coli methionyl-trna synthetase complexed with methionine
Deposited on 2000-06-08, released 2001-03-21
The last revision prior to the SCOP 1.57 freeze date was dated 2001-04-11, with a file datestamp of 2001-04-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.182
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4lA (A:)
    akkilvtcalpyangsihlghmlehiqadvwvryqrmrghevnficaddahgtpimlkaq
    qlgitpeqmigemsqehqtdfagfnisydnyhsthseenrqlseliysrlkengfiknrt
    isqlydpekgmflpdrfvkgtcpkckspdqygdncevcgatyspteliepksvvsgatpv
    mrdsehfffdlpsfsemlqawtrsgalqeqvankmqewfesglqqwdisrdapyfgfeip
    napgkyfyvwldapigymgsfknlcdkrgdsvsfdeywkkdstaelyhfigkdivyfhsl
    fwpamlegsnfrkpsnlfvhgyvtvngakmsksrgtfikastwlnhfdadslryyytakl
    ssriddidlnledfvqrvnadivnkvvnlasrnagfinkrfdgvlaseladpqlyktftd
    aaevigeawesrefgkavreimaladlanryvdeqapwvvakqegrdadlqaicsmginl
    frvlmtylkpvlpklteraeaflnteltwdgiqqpllghkvnpfkalynridmrqvealv
    easke