PDB entry 1f4i

View 1f4i on RCSB PDB site
Description: solution structure of the hhr23a uba(2) mutant p333e, deficient in binding the hiv-1 accessory protein vpr
Class: DNA binding protein,transcription
Keywords: alpha helical bundle, DNA BINDING PROTEIN,TRANSCRIPTION
Deposited on 2000-06-07, released 2000-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uv excision repair protein protein rad23 homolog a
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54725 (0-44)
      • engineered (14)
    Domains in SCOPe 2.07: d1f4ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4iA (A:)
    qekeaierlkalgfeeslviqayfaceknenlaanfllsqnfdde