PDB entry 1f45

View 1f45 on RCSB PDB site
Description: human interleukin-12
Class: cytokine/cytokine
Keywords: interleukin, cytokine, CYTOKINE-CYTOKINE COMPLEX
Deposited on 2000-06-07, released 2001-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.241
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-12 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f45a1, d1f45a2, d1f45a3
  • Chain 'B':
    Compound: interleukin-12 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29459 (Start-196)
      • engineered (190)
    Domains in SCOPe 2.07: d1f45b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f45A (A:)
    iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
    gdagqytchkggevlshsllllhkkedgiwstdilkdqkepknktflrceaknysgrftc
    wwlttistdltfsvkssrgssdpqgvtcgaatlsaervrgdnkeyeysvecqedsacpaa
    eeslpievmvdavhklkyenytssffirdiikpdppknlqlkplknsrqvevsweypdtw
    stphsyfsltfcvqvqgkskrekkdrvftdktsatvicrknasisvraqdryyssswsew
    asvpcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f45A (A:)
    iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
    gdagqytcshsllllhkkedgiwstdilkdqkepknktflrceaknysgrftcwwlttis
    tdltfsvkssrgssdpqgvtcgaatlsaeeyeysvecqedsacpaaeeslpievmvdavh
    klkyenytssffirdiikpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvq
    vqkdrvftdktsatvicrsisvraqdryyssswsewasvpcs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f45B (B:)
    rnlpvatpdpgmfpclhhsqnllravsnmlqkarqtlefypctseeidheditkdktstv
    eaclpleltknesclnsretsfitngsclasrktsfmmalclssiyedlkmyqvefktmn
    akllmdpkrqifldqnmlavidelmqalnfnsetvpqkssleepdfyktkiklcillhaf
    riravtidrvmsylnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f45B (B:)
    qnllravsnmlqkarqtlefypcstveaclpleltknesctsfitngssfmmalclssiy
    edlkmyqvefktmnakllmdpkrqifldqnmlavidelmqalyktkiklcillhafrira
    vtidrvmsylnas