PDB entry 1f42

View 1f42 on RCSB PDB site
Description: the p40 domain of human interleukin-12
Class: cytokine
Keywords: Cytokine
Deposited on 2000-06-07, released 2001-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-12 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f42a1, d1f42a2, d1f42a3
  • Heterogens: MNB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f42A (A:)
    iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
    gdagqytchkggevlshsllllhkkedgiwstdilkdqkepknktflrceaknysgrftc
    wwlttistdltfsvkssrgssdpqgvtcgaatlsaervrgdnkeyeysvecqedsacpaa
    eeslpievmvdavhklkyenytssffirdiikpdppknlqlkplknsrqvevsweypdtw
    stphsyfsltfcvqvqgkskrekkdrvftdktsatvicrknasisvraqdryyssswsew
    asvpcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f42A (A:)
    iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
    gdagqytchkggevlshsllllhkkedgiwstdilkdqkepknktflrceaknysgrftc
    wwlttistdltfsvkssrggvtcgaatlsaervrgdnkeyeysvecqedsacpaaeeslp
    ievmvdavhklkyenytssffirdiikpdppknlqlkplknsrqvevsweypdtwstphs
    yfsltfcvqvqgkskrrvftdktsatvicrknasisvraqdryyssswsewasvpcs