PDB entry 1f40

View 1f40 on RCSB PDB site
Description: solution structure of fkbp12 complexed with gpi-1046, a neurotrophic ligand
Class: isomerase
Keywords: isomerase
Deposited on 2000-06-07, released 2000-11-08
The last revision prior to the SCOP 1.75 freeze date was dated 2000-11-08, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506 binding protein (fkbp12)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1f40a_
  • Heterogens: GPI

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f40A (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle