PDB entry 1f3r

View 1f3r on RCSB PDB site
Description: complex between fv antibody fragment and an analogue of the main immunogenic region of the acetylcholine receptor
Class: immune system
Keywords: ig-fold, immuno complex, antibody-antigen, beta-turn, immune system
Deposited on 2000-06-06, released 2000-06-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholine receptor alpha
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB 223528 (0-9)
      • engineered (3)
      • engineered (9)
  • Chain 'B':
    Compound: fv antibody fragment
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • GB AAB27717 (0-122)
    • GB AAB27718 (138-243)
    Domains in SCOPe 2.05: d1f3rb1, d1f3rb2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3rB (B:)
    qvqllesgpglvrpsetlsltctvsgfsltsfsvswvrhpsgkgpewmgrmwydgytayn
    salksrlsisrdtsknqvflkmnslqtddtgtyyctrdlyggyplgfwyfdfwgpgtmvt
    vssggggsggggsggggsdikltqspsllsasvgdrvtlsckgsqninnylawyqqklge
    apklliyntnslqtgipsrfsgsgsgtdytltisslqpedvatyfcyqynngytfgagtk
    lelkaaeqkliseedln