PDB entry 1f3m

View 1f3m on RCSB PDB site
Description: crystal structure of human serine/threonine kinase pak1
Deposited on 2000-06-05, released 2000-06-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-29, with a file datestamp of 2000-11-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.237
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1f3ma_
  • Chain 'B':
    Domains in SCOP 1.55: d1f3mb_
  • Chain 'C':
    Domains in SCOP 1.55: d1f3mc_
  • Chain 'D':
    Domains in SCOP 1.55: d1f3md_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f3mC (C:)
    sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
    keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
    vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrstmvgtp
    ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe
    klsaifrdflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3mC (C:)
    sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
    keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
    vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqittmvgtpywmapev
    vtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpeklsaifr
    dflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeatk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f3mD (D:)
    sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
    keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
    vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrstmvgtp
    ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe
    klsaifrdflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3mD (D:)
    sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
    keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
    vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpgtpywmapevvt
    rkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpeklsaifrdf
    lnrcldmdvekrgsakellqhqflkiakplssltpliaaakeatk