PDB entry 1f3j

View 1f3j on RCSB PDB site
Description: histocompatibility antigen i-ag7
Deposited on 2000-06-04, released 2000-09-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.221
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3jA (A:)
    ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
    lqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhwe
    pe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3jB (B:)
    erhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyravtelgrhsaeyynk
    qylertraeldtacrhnyeetevptslrrleqpnvaislsrtealnhhntlvcsvtdfyp
    akikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtphqgevytchvehpslkspi
    tvewraq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3jD (D:)
    ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
    lqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhwe
    pe
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3jE (E:)
    erhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyravtelgrhsaeyynk
    qylertraeldtacrhnyeetevptslrrleqpnvaislsrtealnhhntlvcsvtdfyp
    akikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtphqgevytchvehpslkspi
    tvewraq