PDB entry 1f3d

View 1f3d on RCSB PDB site
Description: catalytic antibody 4b2 in complex with its amidinium hapten.
Deposited on 2000-06-02, released 2000-09-13
The last revision prior to the SCOP 1.63 freeze date was dated 2000-09-13, with a file datestamp of 2000-09-13.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.198
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3dH (H:)
    eiqlqqsgpelvkpgasvkvsckasgysfidynihwvkqshgkslewigyivpysggttf
    nqkfkgkatltvdkssstafmhlnsltfedsavyycandydgvywgqgttltvssakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3dJ (J:)
    dvlmtqtplslpvslgdqvsiscrssqsifhsdgktylewhlqkpgqspklliykvskrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrna
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3dK (K:)
    eiqlqqsgpelvkpgasvkvsckasgysfidynihwvkqshgkslewigyivpysggttf
    nqkfkgkatltvdkssstafmhlnsltfedsavyycandydgvywgqgttltvssakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3dL (L:)
    dvlmtqtplslpvslgdqvsiscrssqsifhsdgktylewhlqkpgqspklliykvskrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrna