PDB entry 1f3a

View 1f3a on RCSB PDB site
Description: crystal structure of mgsta1-1 in complex with gsh
Deposited on 2000-06-01, released 2000-10-18
The last revision prior to the SCOP 1.61 freeze date was dated 2000-10-18, with a file datestamp of 2000-10-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3aA (A:)
    agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemigqlvlcppdqreakt
    alakdrtknrylpafekvlkshgqdylvgnrltrvdihllevllyveefdaslltpfpll
    kafksrisslpnvkkflqpgsqrkppmdakqiqearkafki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3aB (B:)
    agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemigqlvlcppdqreakt
    alakdrtknrylpafekvlkshgqdylvgnrltrvdihllevllyveefdaslltpfpll
    kafksrisslpnvkkflqpgsqrkppmdakqiqearkafki