PDB entry 1f37

View 1f37 on RCSB PDB site
Description: structure of a thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus
Deposited on 2000-05-31, released 2000-07-26
The last revision prior to the SCOP 1.59 freeze date was dated 2000-07-26, with a file datestamp of 2000-07-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.225
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1f37a_
  • Chain 'B':
    Domains in SCOP 1.59: d1f37b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f37A (A:)
aefkhvfvcvqdrppghpqgscaqrgsrevfqafmekiqtdpqlfmttvitptgcmnacm
mgpvvvvypdgvwygqvkpedvdeivekhlkggepverlviskgkppgm

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f37B (B:)
aefkhvfvcvqdrppghpqgscaqrgsrevfqafmekiqtdpqlfmttvitptgcmnacm
mgpvvvvypdgvwygqvkpedvdeivekhlkggepverlviskgkppgmf