PDB entry 1f31

View 1f31 on RCSB PDB site
Description: crystal structure of clostridium botulinum neurotoxin b complexed with a trisaccharide
Deposited on 2000-05-31, released 2000-11-01
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-01, with a file datestamp of 2000-11-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.212
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f31A (A:)
    pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
    ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
    rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
    asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
    ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
    rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
    aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
    eeiskehlavykiqmcksvkapgicidvdnedlffiadknsfsddlsknerieyntqsny
    iendfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftdentifqyl
    ysqtfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwvkqivndf
    vieanksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillefipellip
    vvgafllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfytikegmyk
    alnyqaqaleeiikyryniysekeksninidfndinsklneginqaidninnfingcsvs
    ylmkkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylktimpfdls
    iytndtiliemfnkynseilnniilnlrykdnnlidlsgygakvevydgvelndknqfkl
    tssanskirvtqnqniifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsg
    wkisirgnriiwtlidingktksvffeynirediseyinrwffvtitnnlnnakiyingk
    lesntdikdireviangeiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsys
    eylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyi
    gekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisds
    defyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcisk
    wylkevkrkpynlklgcnwqfipkdegwte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f31A (A:)
    pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
    ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
    rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
    asregfggimqmkfcpeyvsvfnnvqeasifnrrgyfsdpalilmhelihvlhglygikv
    ddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivdrln
    kvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetniaen
    ykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqayeei
    skehlavykiqmcksgicidvdnedlffiadknsfsddlsknerieyntqsnyiendfpi
    nelildtdliskielpsentesltdfnvdvpvyekqpaikkiftdentifqylysqtfpl
    dirdisltssfddallfsnkvysffsmdyiktankvveaglfagwvkqivndfvieanks
    ntmdkiadislivpyiglalnvgnetakgnfenafeiagasillefipellipvvgafll
    esyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfytikegmykalnyqaq
    aleeiikyryniysekeksninidfndinsklneginqaidninnfingcsvsylmkkmi
    plaveklldfdntlkknllnyidenkigsaeyekskvnkylktimpfdlsiytndtilie
    mfnkynseilnniilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirv
    tqnqniifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnri
    iwtlidingktksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdi
    reviangeiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsyseylkdfwgnp
    lmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyigekfiirrks
    nsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisdsdefyntiqik
    eydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfciskwylkevkrkp
    ynlklgcnwqfipkdegwte