PDB entry 1f2x

View 1f2x on RCSB PDB site
Description: structure of the single-domain camelid antibody cab-ca05
Deposited on 2000-05-30, released 2000-06-08
The last revision prior to the SCOP 1.59 freeze date was dated 2000-08-30, with a file datestamp of 2000-08-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'K':
    Domains in SCOP 1.59: d1f2xk_
  • Chain 'L':
    Domains in SCOP 1.59: d1f2xl_

PDB Chain Sequences:

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f2xK (K:)
    qvqlvesgggsvqaggslrlscaasgytvstycmgwfrqapgkeregvatilggstyygd
    svkgrftisqdnakntvylqmnslkpedtaiyycagstvastgwcsrlrpydyhyrgqgt
    qvtvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f2xL (L:)
    vqlvesgggsvqaggslrlscaasgytvstycmgwfrqapgkeregvatilggstyygds
    vkgrftisqdnakntvylqmnslkpedtaiyycagstvastgwcsrlrpydyhyrgqgtq
    vtvssr