PDB entry 1f2r

View 1f2r on RCSB PDB site
Description: nmr structure of the heterodimeric complex between cad domains of cad and icad
Class: DNA binding protein
Keywords: alpha-beta roll, protein-protein complex, DNA binding protein
Deposited on 2000-05-29, released 2000-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: caspase-activated DNAse
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1f2rc_
  • Chain 'I':
    Compound: inhibitor of caspase-activated DNAse
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1f2ri_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f2rC (C:)
    mcavlrqpkcvklralhsackfgvaarscqellrkgcvrfqlpmpgsrlclyedgtevtd
    dcfpglpndaelllltagetwhgyvsd
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f2rI (I:)
    melsrgasapdpddvrplkpcllrrnhsrdqhgvaassleelrskacellaidksltpit
    lvlaedgtivddddyflclpsntkfvalacnekwtyndsd