PDB entry 1f2p

View 1f2p on RCSB PDB site
Description: crystal structure of the streptomyces griseus aminopeptidase complexed with l-phenylalanine
Deposited on 2000-05-28, released 2001-08-22
The last revision prior to the SCOP 1.63 freeze date was dated 2001-08-22, with a file datestamp of 2001-08-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1f2pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f2pA (A:)
    apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
    gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
    khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
    tfknyfaglnvpteietegdgrsdhapfknvgvpvgglftgagytksaaqaqkwggtagq
    afdrcyhsscdslsnindtaldrnsdaaahaiwtlss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f2pA (A:)
    apdiplanvkahltqlstiaannggnrahgrpgykasvdyvkakldaagytttlqqftsg
    gatgynlianwpggdpnkvlmagahldsvssgagindngsgsaavletalavsragyqpd
    khlrfawwgaeelgligskfyvnnlpsadrsklagylnfdmigspnpgyfvydddpviek
    tfknyfaglnvpteietersdhapfknvgvpvgglftgagytksaaqaqkwggtagqafd
    rcyhsscdslsnindtaldrnsdaaahaiwtlss