PDB entry 1f2e

View 1f2e on RCSB PDB site
Description: structure of sphingomonad, glutathione s-transferase complexed with glutathione
Class: transferase
Keywords: GST complexed with Glutathione, thioredoxin superfamily fold
Deposited on 2000-05-24, released 2000-06-21
The last revision prior to the SCOP 1.73 freeze date was dated 2000-06-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: SPHINGOMONAS PAUCIMOBILIS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1f2ea1, d1f2ea2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: SPHINGOMONAS PAUCIMOBILIS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1f2eb1, d1f2eb2
  • Chain 'C':
    Compound: glutathione s-transferase
    Species: SPHINGOMONAS PAUCIMOBILIS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1f2ec1, d1f2ec2
  • Chain 'D':
    Compound: glutathione s-transferase
    Species: SPHINGOMONAS PAUCIMOBILIS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1f2ed1, d1f2ed2
  • Heterogens: GTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f2eA (A:)
    mklfispgacslaphialretgadfeavkvdlavrkteagedfltvnpsgkvpaltldsg
    etltenpaillyiadqnpasglapaegsldryrllsrlsflgsefhkafvplfapatsde
    akaaaaesvknhlaaldkelagrdhyagnafsvadiylyvmlgwpayvgidmaaypalga
    yagkiaqrpavgaalkaegla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f2eB (B:)
    mklfispgacslaphialretgadfeavkvdlavrkteagedfltvnpsgkvpaltldsg
    etltenpaillyiadqnpasglapaegsldryrllsrlsflgsefhkafvplfapatsde
    akaaaaesvknhlaaldkelagrdhyagnafsvadiylyvmlgwpayvgidmaaypalga
    yagkiaqrpavgaalkaegla
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f2eC (C:)
    mklfispgacslaphialretgadfeavkvdlavrkteagedfltvnpsgkvpaltldsg
    etltenpaillyiadqnpasglapaegsldryrllsrlsflgsefhkafvplfapatsde
    akaaaaesvknhlaaldkelagrdhyagnafsvadiylyvmlgwpayvgidmaaypalga
    yagkiaqrpavgaalkaegla
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f2eD (D:)
    mklfispgacslaphialretgadfeavkvdlavrkteagedfltvnpsgkvpaltldsg
    etltenpaillyiadqnpasglapaegsldryrllsrlsflgsefhkafvplfapatsde
    akaaaaesvknhlaaldkelagrdhyagnafsvadiylyvmlgwpayvgidmaaypalga
    yagkiaqrpavgaalkaegla