PDB entry 1f1g

View 1f1g on RCSB PDB site
Description: Crystal structure of yeast cuznsod exposed to nitric oxide
Class: oxidoreductase
Keywords: Nitric Oxide, CuZnSOD, OXIDOREDUCTASE
Deposited on 2000-05-18, released 2002-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper-zinc superoxide dismutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f1ga_
  • Chain 'B':
    Compound: copper-zinc superoxide dismutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f1gb_
  • Chain 'C':
    Compound: copper-zinc superoxide dismutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f1gc_
  • Chain 'D':
    Compound: copper-zinc superoxide dismutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f1gd_
  • Chain 'E':
    Compound: copper-zinc superoxide dismutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f1ge_
  • Chain 'F':
    Compound: copper-zinc superoxide dismutase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f1gf_
  • Heterogens: CU, ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f1gA (A:)
    mvqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvs
    agphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvi
    hagqddlgkgdteeslktgnagprpacgvigltn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1gA (A:)
    vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
    gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
    agqddlgkgdteeslktgnagprpacgvigltn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f1gB (B:)
    mvqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvs
    agphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvi
    hagqddlgkgdteeslktgnagprpacgvigltn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1gB (B:)
    vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
    gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
    agqddlgkgdteeslktgnagprpacgvigltn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f1gC (C:)
    mvqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvs
    agphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvi
    hagqddlgkgdteeslktgnagprpacgvigltn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1gC (C:)
    vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
    gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
    agqddlgkgdteeslktgnagprpacgvigltn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f1gD (D:)
    mvqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvs
    agphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvi
    hagqddlgkgdteeslktgnagprpacgvigltn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1gD (D:)
    vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
    gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
    agqddlgkgdteeslktgnagprpacgvigltn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1f1gE (E:)
    mvqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvs
    agphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvi
    hagqddlgkgdteeslktgnagprpacgvigltn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1gE (E:)
    vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
    gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
    agqddlgkgdteeslktgnagprpacgvigltn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1f1gF (F:)
    mvqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvs
    agphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvi
    hagqddlgkgdteeslktgnagprpacgvigltn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f1gF (F:)
    vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
    gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
    agqddlgkgdteeslktgnagprpacgvigltn