PDB entry 1f1f

View 1f1f on RCSB PDB site
Description: crystal structure of cytochrome c6 from arthrospira maxima
Class: electron transport
Keywords: cytochrome c6, heme, protein structure, cyanobacteria, photosynthesis, ELECTRON TRANSPORT
Deposited on 2000-05-18, released 2001-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c6
    Species: Arthrospira maxima [TaxId:129910]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00118 (Start-88)
      • conflict (71)
    Domains in SCOPe 2.07: d1f1fa_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1f1fA (A:)
gdvaagasvfsancaachmggrnvivanktlsksdlakylkgfdddavaavayqvtngkn
ampgfngrlsplqiedvaayvvdqaekgw

    Sequence, based on observed residues (ATOM records): (download) 
    >1f1fA (A:)
dvaagasvfsancaachmggrnvivanktlsksdlakylkgfdddavaavayqvtngkna
mpgfngrlsplqiedvaayvvdqaekgw