PDB entry 1f1c

View 1f1c on RCSB PDB site
Description: crystal structure of cytochrome c549
Class: electron transport
Keywords: dimeric cytochrome
Deposited on 2000-05-18, released 2001-08-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c549
    Species: ARTHROSPIRA MAXIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1f1ca_
  • Chain 'B':
    Compound: cytochrome c549
    Species: ARTHROSPIRA MAXIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1f1cb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f1cA (A:)
    lteelrtfpinaqgdtavlslkeikkgqqvfnaacaqchalgvtrtnpdvnlspealala
    tpprdniaalvdyiknpttydgfveiselhpslkssdifpkmrniseddlynvagyillq
    pkvrgeqwg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f1cB (B:)
    lteelrtfpinaqgdtavlslkeikkgqqvfnaacaqchalgvtrtnpdvnlspealala
    tpprdniaalvdyiknpttydgfveiselhpslkssdifpkmrniseddlynvagyillq
    pkvrgeqwg