PDB entry 1f1c

View 1f1c on RCSB PDB site
Description: crystal structure of cytochrome c549
Deposited on 2000-05-18, released 2001-08-08
The last revision prior to the SCOP 1.57 freeze date was dated 2001-08-08, with a file datestamp of 2001-08-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1f1ca_
  • Chain 'B':
    Domains in SCOP 1.57: d1f1cb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f1cA (A:)
    lteelrtfpinaqgdtavlslkeikkgqqvfnaacaqchalgvtrtnpdvnlspealala
    tpprdniaalvdyiknpttydgfveiselhpslkssdifpkmrniseddlynvagyillq
    pkvrgeqwg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f1cB (B:)
    lteelrtfpinaqgdtavlslkeikkgqqvfnaacaqchalgvtrtnpdvnlspealala
    tpprdniaalvdyiknpttydgfveiselhpslkssdifpkmrniseddlynvagyillq
    pkvrgeqwg