PDB entry 1f13

View 1f13 on RCSB PDB site
Description: recombinant human cellular coagulation factor xiii
Class: coagulation factor
Keywords: coagulation, transglutaminase, transferase, acyltransferase, blood coagulation, coagulation factor
Deposited on 1998-01-16, released 1998-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellular coagulation factor xiii zymogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00488
      • conflict (650)
    Domains in SCOPe 2.07: d1f13a1, d1f13a2, d1f13a3, d1f13a4
  • Chain 'B':
    Compound: cellular coagulation factor xiii zymogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00488
      • conflict (650)
    Domains in SCOPe 2.07: d1f13b1, d1f13b2, d1f13b3, d1f13b4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f13A (A:)
    setsrtafggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtn
    kvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvp
    ivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdt
    yilfnpwceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtcly
    vmdraqmdlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdill
    eyrssenpvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnv
    nskltkdsvwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhg
    hvcfqfdapfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdt
    ykfqegqeeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfr
    nnshnrytitaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlle
    qaslhffvtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketl
    rnvwvhldgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvyge
    ldvqiqrrpsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f13A (A:)
    rtafggrravppnnsnaaeddlptvelqgvvpvnlqeflnvtsvhlfkerwdtnkvdhht
    dkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselq
    sgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnp
    wceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraq
    mdlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrsse
    npvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltk
    dsvwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqf
    dapfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqeg
    qeeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnr
    ytitaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhf
    fvtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvh
    ldgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiq
    rr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f13B (B:)
    setsrtafggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtn
    kvdhhtdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvp
    ivselqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdt
    yilfnpwceddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtcly
    vmdraqmdlsgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdill
    eyrssenpvrygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnv
    nskltkdsvwnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhg
    hvcfqfdapfvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdt
    ykfqegqeeerlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfr
    nnshnrytitaylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlle
    qaslhffvtarinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketl
    rnvwvhldgpgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvyge
    ldvqiqrrpsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f13B (B:)
    tafggrravppnnsnaaeddlptvelqgvvplqeflnvtsvhlfkerwdtnkvdhhtdky
    ennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgk
    wgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwce
    ddavyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdl
    sgrgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpv
    rygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsv
    wnyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdap
    fvfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqee
    erlaletalmygakkplntegvmksrsnvdmdfevenavlgkdfklsitfrnnshnryti
    taylsanitfytgvpkaefkketfdvtleplsfkkeavliqageymgqlleqaslhffvt
    arinetrdvlakqkstvltipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldg
    pgvtrpmkkmfreirpnstvqweevcrpwvsghrkliasmssdslrhvygeldvqiqrr