PDB entry 1f11

View 1f11 on RCSB PDB site
Description: f124 fab fragment from a monoclonal anti-pres2 antibody
Deposited on 2000-05-18, released 2000-08-30
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-06, with a file datestamp of 2001-02-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.184
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f11A (A:)
    dmvltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyvasnlks
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedpftfgsgtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f11B (B:)
    evqlqqsgpelvkpgasvkmsckasgytftdyymkwvkqshgkslewigdinpnnggtgy
    nqkfkgkatltvdkssstaymqlnsltsedsavyycandygstygfaywgqgtlvtvsaa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f11C (C:)
    dmvltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyvasnlks
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedpftfgsgtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f11D (D:)
    evqlqqsgpelvkpgasvkmsckasgytftdyymkwvkqshgkslewigdinpnnggtgy
    nqkfkgkatltvdkssstaymqlnsltsedsavyycandygstygfaywgqgtlvtvsaa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivp