PDB entry 1f0m

View 1f0m on RCSB PDB site
Description: monomeric structure of the human ephb2 sam (sterile alpha motif) domain
Deposited on 2000-05-16, released 2000-07-04
The last revision prior to the SCOP 1.57 freeze date was dated 2000-07-04, with a file datestamp of 2000-07-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.243
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1f0ma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f0mA (A:)
  ytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkilnsi
  qvmraqmnqiq