PDB entry 1f0l

View 1f0l on RCSB PDB site
Description: 1.55 angstrom crystal structure of wild type diphtheria toxin
Deposited on 2000-05-16, released 2000-11-16
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-06, with a file datestamp of 2000-12-06.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.188
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f0lA (A:)
    gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
    daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
    eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
    ymaqacagnrvrrsvgsslscinldwdvirdktktkieslkehgpiknkmsespnktvse
    ekakqyleefhqtalehpelselktvtgtnpvfaganyaawavnvaqvidsetadnlekt
    taalsilpgigsvmgiadgavhhnteeivaqsialsslmvaqaiplvgelvdigfaaynf
    vesiinlfqvvhnsynrpayspghktqpflhdgyavswntvedsiirtgfqgesghdiki
    taentplpiagvllptipgkldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvg
    ngvhanlhvafhrsssekihsneissdsigvlgyqktvdhtkvnsklslffeiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f0lA (A:)
    gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
    daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
    eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
    ymaqacacinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqt
    alehpelselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsv
    mgiadgavhhnteeivaqsialsslmvaqaiplvgeligfaaynfvesiinlfqvvhnsy
    nrpayspghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllp
    tipgkldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrss
    sekihsneissdsigvlgyqktvdhtkvnsklslffeiks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f0lB (B:)
    gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
    daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
    eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
    ymaqacagnrvrrsvgsslscinldwdvirdktktkieslkehgpiknkmsespnktvse
    ekakqyleefhqtalehpelselktvtgtnpvfaganyaawavnvaqvidsetadnlekt
    taalsilpgigsvmgiadgavhhnteeivaqsialsslmvaqaiplvgelvdigfaaynf
    vesiinlfqvvhnsynrpayspghktqpflhdgyavswntvedsiirtgfqgesghdiki
    taentplpiagvllptipgkldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvg
    ngvhanlhvafhrsssekihsneissdsigvlgyqktvdhtkvnsklslffeiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f0lB (B:)
    gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
    daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
    eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
    ymaqacacinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqt
    alehpelselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsv
    mgiadgavhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhn
    synrpayspghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvl
    lptipgkldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhr
    sssekihsneissdsigvlgyqktvdhtkvnsklslffeiks