PDB entry 1ez4

View 1ez4 on RCSB PDB site
Description: crystal structure of non-allosteric l-lactate dehydrogenase from lactobacillus pentosus at 2.3 angstrom resolution
Deposited on 2000-05-10, released 2001-12-28
The last revision prior to the SCOP 1.67 freeze date was dated 2001-12-28, with a file datestamp of 2001-12-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ez4A (A:)
    smpnhqkvvlvgdgavgssyafamaqqgiaeefvivdvvkdrtkgdaldledaqaftapk
    kiysgeysdckdadlvvitagapqkpgesrldlvnknlnilssivkpvvdsgfdgiflva
    anpvdiltyatwkfsgfpkervigsgtsldssrlrvalgkqfnvdprsvdayimgehgds
    efaaystatigtrpvrdvakeqgvsdddlakledgvrnkaydiinlkgatfygigtalmr
    iskailrdenavlpvgaymdgqyglndiyigtpaiiggtglkqiiesplsadelkkmqds
    aatlkkvlndglaelenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ez4A (A:)
    smpnhqkvvlvgdgavgssyafamaqqgiaeefvivdvvkdrtkgdaldledaqaftapk
    kiysgeysdckdadlvvitagalvnknlnilssivkpvvdsgfdgiflvaanpvdiltya
    twkfsgfpkervigsgtsldssrlrvalgkqfnvdprsvdayimgehgdsefaaystati
    gtrpvrdvakeqgvsdddlakledgvrnkaydiinlkgatfygigtalmriskailrden
    avlpvgaymdgqyglndiyigtpaiiggtglkqiiesplsadelkkmqdsaatlkkvlnd
    glaelen
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ez4B (B:)
    smpnhqkvvlvgdgavgssyafamaqqgiaeefvivdvvkdrtkgdaldledaqaftapk
    kiysgeysdckdadlvvitagapqkpgesrldlvnknlnilssivkpvvdsgfdgiflva
    anpvdiltyatwkfsgfpkervigsgtsldssrlrvalgkqfnvdprsvdayimgehgds
    efaaystatigtrpvrdvakeqgvsdddlakledgvrnkaydiinlkgatfygigtalmr
    iskailrdenavlpvgaymdgqyglndiyigtpaiiggtglkqiiesplsadelkkmqds
    aatlkkvlndglaelenk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ez4C (C:)
    smpnhqkvvlvgdgavgssyafamaqqgiaeefvivdvvkdrtkgdaldledaqaftapk
    kiysgeysdckdadlvvitagapqkpgesrldlvnknlnilssivkpvvdsgfdgiflva
    anpvdiltyatwkfsgfpkervigsgtsldssrlrvalgkqfnvdprsvdayimgehgds
    efaaystatigtrpvrdvakeqgvsdddlakledgvrnkaydiinlkgatfygigtalmr
    iskailrdenavlpvgaymdgqyglndiyigtpaiiggtglkqiiesplsadelkkmqds
    aatlkkvlndglaelenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ez4C (C:)
    smpnhqkvvlvgdgavgssyafamaqqgiaeefvivdvvkdrtkgdaldledaqaftapk
    kiysgeysdckdadlvvitagalvnknlnilssivkpvvdsgfdgiflvaanpvdiltya
    twkfsgfpkervigsgtsldssrlrvalgkqfnvdprsvdayimgehgdsefaaystati
    gtrpvrdvakeqgvsdddlakledgvrnkaydiinlkgatfygigtalmriskailrden
    avlpvgaymdgqyglndiyigtpaiiggtglkqiiesplsadelkkmqdsaatlkkvlnd
    glaelen
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ez4D (D:)
    smpnhqkvvlvgdgavgssyafamaqqgiaeefvivdvvkdrtkgdaldledaqaftapk
    kiysgeysdckdadlvvitagapqkpgesrldlvnknlnilssivkpvvdsgfdgiflva
    anpvdiltyatwkfsgfpkervigsgtsldssrlrvalgkqfnvdprsvdayimgehgds
    efaaystatigtrpvrdvakeqgvsdddlakledgvrnkaydiinlkgatfygigtalmr
    iskailrdenavlpvgaymdgqyglndiyigtpaiiggtglkqiiesplsadelkkmqds
    aatlkkvlndglaelenk