PDB entry 1eyx

View 1eyx on RCSB PDB site
Description: crystal structure of r-phycoerythrin at 2.2 angstroms
Class: photosynthesis
Keywords: r-phycoerythrin, macroseeding, twin, protein structure, sequences, phycobiliprotein, red algae
Deposited on 2000-05-09, released 2000-11-22
The last revision prior to the SCOP 1.75 freeze date was dated 2001-03-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.18
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: r-phycoerythrin
    Species: GRACILARIA CHILENSIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1eyxa_
  • Chain 'B':
    Compound: r-phycoerythrin
    Species: GRACILARIA CHILENSIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1eyxb_
  • Chain 'G':
    Compound: r-phycoerythrin
    Species: GRACILARIA CHILENSIS
  • Chain 'H':
    Compound: r-phycoerythrin
    Species: GRACILARIA CHILENSIS
  • Chain 'K':
    Compound: r-phycoerythrin
    Species: GRACILARIA CHILENSIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1eyxk_
  • Chain 'L':
    Compound: r-phycoerythrin
    Species: GRACILARIA CHILENSIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1eyxl_
  • Heterogens: SO4, BLA, CYC, PUB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eyxA (A:)
    mksvittvisaadsagrfpsssdlesvqgniqrasarleaaeklasnheavvkeagdacf
    gkygylknpgeagenqekinkcyrdidhymrlvnyslviggtgpldewgiagarevyrtl
    nlptsayiaafaftrdrlcgprdmsaqagveystaldyiinsls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eyxB (B:)
    mldafsrvisnadakaayvggsdlqalrtfisdgnkrldavnyivsnsscivsdaisgmi
    cenpglitpggncytnrrmaaclrdgeiilryisyallagdssvledrclnglketyial
    gvptnstvravsimkaavgafisntasqrkgeviegdcsalaaeiasycdrisaavs
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eyxK (K:)
    mksvittvisaadsagrfpsssdlesvqgniqrasarleaaeklasnheavvkeagdacf
    gkygylknpgeagenqekinkcyrdidhymrlvnyslviggtgpldewgiagarevyrtl
    nlptsayiaafaftrdrlcgprdmsaqagveystaldyiinsls
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eyxL (L:)
    mldafsrvisnadakaayvggsdlqalrtfisdgnkrldavnyivsnsscivsdaisgmi
    cenpglitpggncytnrrmaaclrdgeiilryisyallagdssvledrclnglketyial
    gvptnstvravsimkaavgafisntasqrkgeviegdcsalaaeiasycdrisaavs