PDB entry 1eym

View 1eym on RCSB PDB site
Description: fk506 binding protein mutant, homodimeric complex
Class: isomerase
Keywords: rotamase; isomerase; ligand-reversible dimer
Deposited on 2000-05-07, released 2000-08-09
The last revision prior to the SCOP 1.73 freeze date was dated 2000-08-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.23
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506 binding protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62942 (0-106)
      • engineered (35)
    Domains in SCOP 1.73: d1eyma_
  • Chain 'B':
    Compound: fk506 binding protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62942 (0-106)
      • engineered (35)
    Domains in SCOP 1.73: d1eymb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eymA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkmdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eymB (B:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkmdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle