PDB entry 1ey7

View 1ey7 on RCSB PDB site
Description: structure of s. nuclease stabilizing mutant s128a
Deposited on 2000-05-05, released 2000-10-18
The last revision prior to the SCOP 1.59 freeze date was dated 2000-10-18, with a file datestamp of 2000-10-18.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ey7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ey7A (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
    kaeaqakkeklniws