PDB entry 1exr

View 1exr on RCSB PDB site
Description: the 1.0 angstrom crystal structure of ca+2 bound calmodulin
Class: metal transport
Keywords: calmodulin, high resolution, disorder, metal transport
Deposited on 2000-05-03, released 2000-09-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.136
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Paramecium tetraurelia [TaxId:5888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1exra_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1exrA (A:)
    aeqlteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltdde
    vdemireadidgdghinyeefvrmmvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1exrA (A:)
    eqlteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng
    tidfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltddev
    demireadidgdghinyeefvrmmvs